Memory Beta, non-canon Star Trek Wiki

A friendly reminder regarding spoilers! At present the expanded Trek universe is in a period of major upheaval with the continuations of Discovery and Prodigy, the advent of new eras in gaming with the Star Trek Adventures RPG, Star Trek: Infinite and Star Trek Online, as well as other post-57th Anniversary publications such as the ongoing IDW Star Trek comic and spin-off Star Trek: Defiant. Therefore, please be courteous to other users who may not be aware of current developments by using the {{spoiler}}, {{spoilers}} OR {{majorspoiler}} tags when adding new information from sources less than six months old (even if it is minor info). Also, please do not include details in the summary bar when editing pages and do not anticipate making additions relating to sources not yet in release. THANK YOU

READ MORE

Memory Beta, non-canon Star Trek Wiki
Register
No edit summary
(28 intermediate revisions by 8 users not shown)
Line 1: Line 1:
 
{{novel
 
{{novel
| type = novel
+
|type = novel
| title = Fire with Fire
+
|title = Fire with Fire
| cover image = [[file:pROM 01.jpg|220px|Cover image.]]
+
|cover image = PROM 01.jpg
| artist = [[Tobias Richter]]
+
|artist = [[Tobias Richter]]
| series = {{sT|Prometheus}}
+
|series = {{ST|Prometheus}}
| author = [[Christian Humberg]], [[Bernd Perplies]]
+
|author = [[Christian Humberg]], [[Bernd Perplies]]
| publisher = [[Cross Cult]]
+
|publisher = [[Cross Cult]]
| format = [[paperback]], [[ebook]]
+
|format = [[paperback]], [[ebook]]
| published = [[July]] [[2016]]
+
|published = [[July]] [[2016]]
| pages = 450
+
|pages = 450
| ISBN = 9783864258510
+
|ISBN = 9783864258510
| date = [[2385|28 October - 16 November 2385]]
+
|date = [[2385|28 October - 16 November 2385]]
 
|stardate =
 
 
|altcover = Fire with Fire.jpg
| stardate =
 
 
|caption =
| altcover =[[file:fire with Fire.jpg|220px|Cover image.]]
 
| caption =
 
 
|}}
 
|}}
'''''Fire with Fire''''' ([[German]] ''Feuer gegen Feuer'') is a ''[[Star Trek: Prometheus]]'' [[novel]] co-written by [[Christian Humberg]] and [[Bernd Perplies]], released in [[July]] [[2016]]. It is the first book in the series.
+
'''''Fire with Fire''''' ([[German]] ''Feuer gegen Feuer'') is a ''[[Star Trek: Prometheus]]'' [[novel]] co-written by [[Christian Humberg]] and [[Bernd Perplies]], released in [[July]] [[2016]] in the German language; the English translation started appearing in bookstores on November 22, 2017. It is the first book in the series.
   
 
==Description==
 
==Description==
 
:''Nahe der Grenze zum [[Klingon Empire|Klingonischen Reich]] ereignen sich mehrere brutale [[terrorism|Terroranschläge]], die Tausende von Toten fordern.''
 
:''Nahe der Grenze zum [[Klingon Empire|Klingonischen Reich]] ereignen sich mehrere brutale [[terrorism|Terroranschläge]], die Tausende von Toten fordern.''
 
:''Wer steckt hinter den Angriffen? Sind es Fanatiker aus dem fremdartigen Volk der [[Renao]], das im benachbarten [[Lembatta Cluster|Lembatta-Cluster]] siedelt? Oder hat der zwielichtige [[Typhon Pact|Typhon-Pakt]] seine Finger im Spiel? Die [[Starfleet|Sternenflotte]] entsendet die [[USS Prometheus (NX-59650)|U.S.S. Prometheus]], ihr kampfstärkstes Schiff, in die Grenzregion, um das Rätsel zu lösen, bevor der nächste [[war|Krieg]] in [[the galaxy|der Galaxis]] ausbricht.''
 
:''Wer steckt hinter den Angriffen? Sind es Fanatiker aus dem fremdartigen Volk der [[Renao]], das im benachbarten [[Lembatta Cluster|Lembatta-Cluster]] siedelt? Oder hat der zwielichtige [[Typhon Pact|Typhon-Pakt]] seine Finger im Spiel? Die [[Starfleet|Sternenflotte]] entsendet die [[USS Prometheus (NX-59650)|U.S.S. Prometheus]], ihr kampfstärkstes Schiff, in die Grenzregion, um das Rätsel zu lösen, bevor der nächste [[war|Krieg]] in [[the galaxy|der Galaxis]] ausbricht.''
  +
  +
English version:
  +
  +
:''A mysterious terrorist organization has carried out several attacks against the [[Federation]] and Klingon Empire. Tensions are running high in a region already crippled by conflict. The perpetrators are tracked to the Lembatta Cluster, a mysterious region of space whose inhabitants, the Renao, regard the [[Alpha Quadrant]]'s powers as little more than conquering tyrants. The Federation are desperate to prevent more bloodshed, and so have sent their flagship, the U.S.S. Prometheus, into the Cluster to investigate the threat before all-consuming war breaks out.''
  +
  +
==Summary==
  +
[[Starbase 91]] is destroyed in a terrorist attack and a group calling themselves the [[Purifying Flame]] from the reclusive Renao species claim responsibility. The ''USS Prometheus'' is assigned to investigate: Its captain, [[Richard Adams]], lost his niece [[Karen Adams|Karen]] in the attack and its crew includes the only Renao in Starfleet, [[Lieutenant]] [[Jassat ak Namur]].
  +
  +
Further attacks destroy the Klingon mining planet of [[Tika 4b]] and an observation station on [[Cestus III]]. The Klingons despatch the {{IKS|Bortas|Vor'cha class}}, commanded by [[Captain]] [[Kromm]], a drunken member of a noble family, to assist the ''Prometheus'', accompanied by [[Alexander Rozhenko]]. [[Spock]] is also sent as a Federation special envoy.
  +
  +
Examination of the wreckage of Starbase 91 suggests that the attackers used [[Romulan]] ships and explosives to launch a suicide attack. Spock has [[Thokal]], a colleague in the [[Unification movement]] and former [[Tal Shiar]] member, investigate and determine that the Renao have acquired surplus equipment that went missing when the [[Imperial Romulan State]] was re-absorbed into the [[Romulan Star Empire|empire]].
  +
  +
The Federation and Klingon personnel search the Renao homeworld, [[Onferin]], but ''Prometheus'' chief of security [[Lenissa zh'Thiin]] and chief engineer [[Jenna Winona Kirk]] (great-great-niece of [[James T. Kirk|James T.]]) are captured by the Purifying Flame along with their Klingon colleagues, and held hostage so both Starfleet and the Klingons leave the planet.
  +
  +
Jassat reluctantly reports two old friends as Purifying Flame sympathisers and the Klingons capture and torture them, learning the location of the Purifying Flame stronghold. Kromm leads a joint operation to attack the base and the terrorists flee in space craft. The ''Prometheus'' and ''Bortas'' intercept them and rescue the hostages but many escape using a space-folding technique. Spock performs a [[mind meld]] with a captured terrorist and learns the Renao are being influenced by someone. The two ships head further into the cluster in search of answers.
   
 
==References==
 
==References==
 
===Characters===
 
===Characters===
  +
====USS ''Prometheus'' personnel====
:[[Richard Adams]] • [[Sarita Carson]] • {{dis|Green|USS Valiant}}
 
  +
:[[Richard Adams]] • [[Geron Barai]] • [[Sarita Carson]] • [[Cenia]] • [[Chell]] • [[Massimo Ciarese]] • [[Isabelle Courmont]] • [[Matthieu Curdin]] • {{dis|Elisa Flores|USS Prometheus}} • [[Gleeson]] • {{dis|Gral|USS Prometheus}} • [[Amanda Harris]] • [[Jansen]] • [[Jenna Winona Kirk]] • [[Mendon]] • [[Alex Meyer]] • {{dis|Moba|Bolian}} • {{dis|Moore|USS Prometheus}} • [[Jassat ak Namur]] • [[John Paxon]] • [[Roaas]] • [[Senok]] • [[Simanek]] • {{dis|T'Sai|USS Prometheus}} • [[Tabor Resk]] • [[Shantherin th'Talias]] • [[Lenissa zh'Thiin]] • [[Tric]] • [[Robert Vogel]] • [[Wilorin]] • [[Paul Winter]]
  +
{{ref}} [[Gaav]] • [[Garrett Moss]] • [[T'Shanik]]
  +
  +
====USS ''Valiant'' personnel====
  +
:[[Bhahani]] • {{dis|Clarke|USS Valiant}} • [[Mark Edwards]] • [[Franco]] • [[Jeremy Haden]] • [[Linda Nozawa]] • [[Peter Schwartz]]
 
{{ref}} [[Denning]] • {{dis|Green|USS Valiant}}
  +
  +
====Deep Space 9 personnel and residents====
  +
:[[Cenn Desca]] • [[Morn]] • [[Nog]] • [[Miles O'Brien]] • [[Quark]] • [[Ro Laren]]
  +
{{ref}} [[Keiko O'Brien]]
  +
  +
====Starbase 91 personnel====
  +
:[[Karen Adams]] • {{dis|Agram|Starbase 91}} • {{dis|Alari|Starbase 91}} • [[Julie Butchko]] • [[Fraxa]] • [[Goldwasser]] • [[Gabriel Marceau]]
  +
{{ref}} [[Dimitrios Charistes]] • [[Cox]] • [[Hillenbrand]]
  +
  +
====Other Starfleet personnel====
  +
:[[Leonard James Akaar]] • [[Ezri Dax]] • [[Alynna Nechayev]] • {{dis|Markus Rohde|Admiral}} • [[Sendak]]
  +
{{ref}} [[Julian Bashir]] • [[Sam Bowers]] • [[Rhea Kadani]] • [[James T. Kirk]] • [[Jamie Samantha Kirk]] • [[Kimitake Noguchi]] • [[Jean-Luc Picard]] • [[Worf]]
  +
  +
====IKS ''Bortas'' personnel====
  +
:[[Bocar]] • [[Brukk]] • {{dis|Chumarr|IKS Bortas}} • [[Grakk]] • {{dis|Klarn|Klingon}} • [[Kromm, son of Kaath]] • [[Kroge]] • [[L'emka]] • [[Mokbar]] • [[Nuk]] • [[Raspin]] • [[Rooth]] • [[Ruut]] • [[Toras]]
  +
  +
====Other Klingons====
  +
:[[Britok, son of Graak]] • [[Grotek, son of Braktal]] • [[K'mpoch]] • [[K'mtok]] • [[Korrt]] • [[Martok]] • [[Rooth, son of K'mpath]] • [[Alexander Rozhenko]]
  +
{{ref}} [[Gowron]] • [[Kaath]] • [[Kahless (clone)]] • [[Kahless the Unforgettable]]
  +
  +
====Renao====
  +
:[[Gilad ak Bahail]] • [[Namoud ak Bahail]] • [[Joruul ak Bhedal]] • [[ak Bradul]] • [[Evykk ak Brusal]] • [[Mossam ak Foral]] • [[Himad ak Genos]] • [[Joruun]] • [[Kumaah]] • [[Moadas ak Lavoor]] • [[ak Manas]] • [[Seresh ak Momad]] • [[Shamar ak Mousal]] • [[ak Partami]] • [[Ramou]]
  +
{{ref}} [[Creatress]]
  +
  +
====Other characters====
  +
:[[Rah-Ban]] • [[Vol-Ban]] • [[Altoun Djinian]] • [[Cort Enaren]] • [[Glomp]] (Mak) • [[Hararis]] • {{dis|Keval|Romulan}} • [[Kyll]] • [[Maldaro]] • [[Rento]] • [[Elenor Sarin]] • [[Spock]] • [[Kellessar zh'Tarash]] • [[Thokal]] • [[unnamed Edosians]]
  +
{{ref}} [[Carol Adams]] • [[Nanietta Bacco]] • [[Julian Bashir (Changeling)]] • [[Zefram Cochrane]] • [[Blessed Exchequer|Divine Exchequer]] • [[Donatra]] • [[Thomas Gray]] • [[K'Ehleyr]] • [[Gell Kamemor]] • [[George Samuel Kirk, Jr.]] • [[Mak]] • [[Redjac]] • [[Helena Rozhenko]] • [[Sergey Rozhenko]] • [[Sarek]] • [[Gideon Seyetik]] • [[Shinzon]] • [[Son of the Ancient Reds]] • [[Uzaveh]] • [[Thomas Wolfe]]
   
 
===Starships and vehicles===
 
===Starships and vehicles===
:{{uSS|Aventine}} ({{class|Vesta}}) • {{uSS|Bohr|Merian class}} ({{class|Merian}}) • {{iKS|Bortas}} ({{class|Vor'cha}}) • {{uSS|Prometheus|NX-59650}} ({{class|Prometheus}}) • {{uSS|Valiant|NCC-1709}} ({{class|Constitution}})
+
:''[[Aoul-5]]'' • {{USS|Aventine}} ({{class|Vesta}}) • {{IKS|Bortas|Vor'cha class}} ({{class|Vor'cha}}) • {{ship||Charles Coryell|shuttlecraft}} • [[Kraanal]] • {{USS|Lakota|NCC-63444-B}} ({{class|Akira}}) • ''[[Medibha]]'' • [[monorail]] • {{USS|Prometheus|NX-59650}} ({{class|Prometheus}}) • {{dis|Rigelian freighter|24th century}} • [[Romulan transport]] • [[Scorpion class]] ([[attack fighter]]) • {{USS|Solaris}} • [[Tzenkethi marauder]] • {{USS|Valiant|NCC-1709}} ({{class|Constitution}}) • ''[[Vel-Tekk]]'' ([[mercenary ship]]) • {{dis|yolok|mining vehicle}}
  +
{{ref}} ''[[ChR Gal Gath'thong|Algeron]]'' • {{class|Antares|Starfleet}} • {{USS|Bohr|Merian class}} ({{class|Merian}}) • {{USS|Bougainville|NCC-61809}} • {{USS|Capitoline}} • {{USS|Defiant|NX-74205) (I}} • {{USS|Enterprise|NCC-1701}} • {{USS|Enterprise|NCC-1701-E|-E}} • [[escape pod]] • {{class|Excelsior}} • {{class|Intrepid|light cruiser}} • {{USS|Iron Horse}} • {{class|Miranda}} • {{USS|Red Cloud}} • ''[[Scimitar]]'' • {{USS|Sutherland|NCC-72015}} • {{USS|Voyager}} • [[work drone]] • {{USS|Wyoming|NCC-43730}} ({{class|Mediterranean}}) • {{USS|Yukon}}
   
 
===Locations===
 
===Locations===
:[[Earth]] ([[Palais de la Concorde]], [[Paris]]) • [[Deep Space 9 (II)]] ({{class|Frontier|starbase}}) • [[Korinar]] • [[Milky Way Galaxy]] • [[Lembatta Cluster]] • [[Lembatta Prime]] • [[Onferin]] • [[Romulus]] ([[Ki Baratan]]) • [[Qo'noS]] ([[Great Hall]], [[First City]]) • [[starbase]] • [[Starbase 91]] ({{class|Watchtower}}) • [[Tika 4b]]
+
:[[Achernar II]] ({{dis|Heliopolis|Achernar II}}) • [[Alpha Quadrant]] [[Aoul]] [[Bajor sector]] • [[Bajoran wormhole]] • [[Beta Quadrant]] • [[Cestus III]] • [[Cestus system]] • [[Deep Space 9 (II)]] ({{dis|Quark's|II}}) ({{class|Frontier|starbase}}) • [[Earth]] ([[Paris]] ([[Palais de la Concorde]]) • [[San Francisco]] ([[Starfleet Headquarters]])) • [[Korinar III]] ([[Chic Inn]]) • [[LC-13]] [[LC-13-II]] • [[Lembatta Cluster]] • [[Lembatta Prime]] ([[Sun City]]) • [[Milky Way Galaxy]] • [[Onferin]] ([[Auroun]] • [[factory]] • [[Konuhbi]] • [[Massoa]]) • [[Qo'noS]] ([[Great Hall]], [[First City]]) • [[Romulus]] ([[Apnex Sea]] • [[Ki Baratan]] ([[Admiral Valdore Building]] • [[Chalandru]])) • [[Starbase 91]] ([[Starlight Café]]) ({{class|Watchtower}}) • [[Tika IV]] • [[Tika 4b]] • [[Tika system]]
  +
{{ref}} [[Acina]] • [[Andor]] • [[Antares]] • [[B'hava'el]] • [[Badlands]] • [[Benzar]] • [[Beta Antares Ship Yards]] • [[Betazed]] • [[Bharatrum]] • [[Capella IV]] • [[Catoumni]] • [[Chalna]] • [[Deep Space 9]] • [[Delta Quadrant]] • [[Earth]] ([[Alcatraz]] • [[Greece]] • [[New Zealand]] • [[San Francisco]] ([[Baker Beach]] • [[Lombard Street]] • [[San Francisco Bay]] • [[Starfleet Communications Research Center]])) • [[Earth Outpost Station]] • [[Echelon 1]] • [[Epsilon 119]] • [[Federation-Klingon border]] • [[Ferasa]] • [[Ferenginar]] • [[Gamma Quadrant]] • [[Iad]] • [[Lhoeel]] • ([[Narad Sea]]) • [[Munjeb III]] • [[New France]] • Onferin ([[Bhorau Desert]]) • [[Praxis]] • {{planet|Rantal}} • [[Remus]] • [[Romulan Neutral Zone]] • [[Sector 221-G]] • [[Silva sector]] • [[Sol sector]] • [[Starbase 7]] • [[Tullinar VI]] • [[Utopia Planitia Fleet Yards]] • [[Vorta Vor]] • {{planet|Vulcan}} • [[Xhehenem]] • [[Yssab]]
   
 
===Races and cultures===
 
===Races and cultures===
:[[Andorian]] • [[Caitian]] • [[Benzite]] • [[Bolian]] • [[Human]] • [[Klingon]] • [[Renao]] • [[Romulan]] • [[Vulcan]]
+
:[[Andorian]] • [[Bajoran]] • [[Benzite]] • [[Betazoid]] • [[Bolian]] • [[Caitian]] • [[Capellan]] • [[Cardassian]] • [[Chalnoth]] • [[Edosian]] • [[Ferengi]] • [[Grazerite]] • [[Human]] ([[French]] • [[German]] • [[Irish]] • [[Italian]] • [[Japanese]] • [[Norwegian]] • [[Sudanese]]) • [[Klingon]] • [[Lurian]] • [[Miradorn]] • [[Orion]] • [[Rantal]] • [[Renao]] • [[Romulan]] • [[Tellarite]] • [[Tiburon|Tiburonian]] • [[Trill]] ([[Trill symbiont]]) • [[Tzenkethi]] • [[Vulcan]]
  +
{{ref}} [[Borg]] • [[Breen]] • [[Changeling]] • Human ([[Aztec]] • [[Mayan]]) • [[Kinshaya]] • [[Nuvian]] • [[Pakled]] • [[Tholian]]
   
 
===States and organizations===
 
===States and organizations===
  +
:[[Cemoudan]] • [[Council of the Spheres]] • [[Federation Council]] • [[Federation Diplomatic Corps]] • [[Federation News Service]] • [[Ferengi Alliance]] • [[Home Spheres]] • [[House of DachoH]] • [[House of Konjah]] • [[House of Kruge]] • [[Klingon Defense Force]] • [[Klingon Empire]] • [[Klingon High Council]] • [[Orion Syndicate]] • [[Purifying Flame]] • [[Romulan Star Empire]] • [[Spherekeepers of Auroun]] • [[Starfleet]] • [[Starfleet Command]] • [[Starfleet Intelligence]] • [[Typhon Pact]] • [[Tzenkethi Coalition]] • [[United Federation of Planets]]
:[[Klingon Empire]] • [[Starfleet]] • [[United Federation of Planets]]
 
  +
{{ref}} [[Cardassian Union]] • [[Coalition of Planets]] • [[Ferengi Commerce Authority]] • [[Gorn Hegemony]] • [[Imperial Romulan State]] • [[Officer Exchange Program]] • [[Pathfinder Project]] • [[Project Full Circle]] • [[Project Genesis]] • [[Romulan Defense Ministry]] • [[Romulan Senate]] • [[Starfleet Academy]] • [[Starfleet Communications]] • [[Starfleet Corps of Engineers]] • [[Starfleet Security]] • [[Tal Shiar]] • [[Unification movement]] • [[Warp-Speed Classic Vaudeville of Amelia Lukarian]]
   
 
===Ranks and titles===
 
===Ranks and titles===
  +
:[[admiral]] • [[agent]] • [[aide]] • [[ambassador]] • [[artist]] • [[bartender]] • [[bekk]] • [[captain]] • [[carney]] • [[Chancellor of the High Council of the Klingon Empire]] • [[chief engineer]] • [[chief medical officer]] • [[chief of operations]] • [[commander]] • [[Commander-in-Chief of the Federation Starfleet]] • [[communications officer]] • [[concubine]] • [[conn officer]] • [[councilor]] • [[counselor]] • [[dancer]] • [[data analyst]] • [[assistant chief engineer|deputy chief engineer]] • [[assistant chief of security|deputy chief of security]] • [[diplomat]] • [[ensign]] • [[farmer]] • [[Federation Ambassador to the Klingon Empire]] • [[Ferengi Ambassador to the Republic of Bajor]] • [[first officer]] • [[fleet admiral]] • [[foreman]] • [[governor]] • [[helmsman]] • [[sphere keeper]] • [[Klingon Ambassador to the United Federation of Planets]] • [[lieutenant]] • [[lieutenant commander]] • [[lieutenant junior grade]] • [[linguist]] • [[lyricist]] • [[major]] • [[manager]] • [[mercenary]] • [[merchant]] • [[navigator]] • [[operations officer]] • [[pilot]] • {{dis|poet|profession}} • [[Praetor of the Romulan Star Empire]] • [[President of the Home Spheres]] • [[President of the United Federation of Planets]] • [[Renao Defense Minister]] • [[science officer]] • [[second officer]] • [[security chief]] • [[senior chief petty officer]] • [[smuggler]] • [[tactical officer]] • [[terrorist]] • [[theologian]] • [[tour guide]] • [[uhlan]] • [[vegetarian]] • [[waiter]] • [[watch officer]] • [[xenozoologist]] • [[yeoman]]
:[[captain]] • [[Federation Starfleet ranks]] • [[Federation Starfleet ranks (2370s-2380s)]] • [[Klingon ranks]]
 
  +
  +
===Science and technology===
  +
:[[anicium]] • [[anthracite]] • [[antiproton]] • [[arcology]] • [[artificial gravity]] • [[astrophysics]] • [[atmosphere]] ([[magnetosphere]]) • [[biobed]] • [[biology]] • [[blood]] • [[camera]] • [[carbon monoxide]] • [[centrifugal force]] • [[cloaking device]] • [[clone]] • [[combadge]] • [[communicator]] • [[data chip]] • [[data pad]] • [[deflector shield]] • [[dilithium]] • [[disruptor]] • [[disruptor cannon]] • [[eclipse]] • [[electromagnetic spectrum]] • [[EMH|EMH Mark II]] • [[energy field]] • [[enzyme]] • [[EPS manifold]] • [[EV suit]] • [[flashlight]] • [[gas giant]] • [[genetics]] • [[hand scanner]] • [[holodeck]] • [[holoemitter]] • [[holoscreen]] • [[holovid]] • [[homing beacon]] • [[hypersubspace speed]] • [[impulse drive]] • [[inertial dampener]] • [[Interphase cloaking device]] • [[ionized particles]] • [[isolinear rod]] • [[lamp]] • [[life support]] • [[liver]] • [[mass]] • [[matter-antimatter reactor]] • [[miner's lamp]] • [[mining]] • [[molecule]] • [[multi-vector assault mode]] • [[nebula]] • [[neutral atom]] • [[nitrogen]] • [[oxygen]] • [[perma-concrete]] • [[phaser]] • [[phaser array]] • [[phaser rifle]] • [[photon torpedo]] • [[plasma]] • [[protomatter]] • [[psychology]] • [[quantum slipstream drive]] • [[radiation]] • [[reactor breach]] • [[red giant]] • [[replicator]] • [[respirator]] • [[rodinium]] • [[self destruct]] • [[sensor array]] • [[Shedai meta-genome]] • [[shield generator]] • [[shock pistol]] • [[silicate]] • [[solar wind]] • [[sound wave]] • [[subspace communications]] • [[supernova]] • [[tachyon]] • [[tachyon detection grid]] • [[tachyon radiation]] • [[tekasite]] • [[tractor beam]] • [[transparent aluminum]] • [[transporter]] • [[tricobalt]] • [[tricorder]] • [[trilithium]] • [[Type-XII phaser]] • [[ultritium]] • [[universal translator]] • [[volcano]] • [[warp bubble]] • [[warp drive]] • [[warp factor]] • [[warp field generator coil]] • [[warp nacelle]] • [[xenozoology]]
   
 
===Other references===
 
===Other references===
  +
:[[2156]] • [[2161]] • [[2275]] • [[2305]] • [[2333]] • [[2359]] • [[2370]] • [[2374]] • [[2375]] • [[2376]] • [[2381]] • [[2382]] • [[2340s]] • [[2350s]] • [[2360s]] • [[alcohol]] • [[algae]] • [[Andorian ale]] • [[Andorian fertility crisis]] • [[apartment]] • [[armor]] • [[assassination]] • [[bank]] • ''[[bat'leth]]'' • [[Battle of Cardassia]] • {{dis|Battle of Vulcan|2381}} • [[black market]] • [[blackmail]] • [[blindfold]] • [[bloodwine]] • [[Borg Invasion of 2381]] • ''[[bri]]'' • ''[[chuSwI']]'' • [[citrus]] • [[clay]] • [[clothing|cloak]] • [[coffee]] • [[cold war]] • [[contract]] • [[impact crater|crater]] • ''[[d'k tahg]]'' • [[dabo]] • [[dais]] • [[darts]] • [[dedication plaque]] • ''[[DenIb Qatlh]]'' • [[Dom-jot]] • [[Dominion War]] • [[Dreaak]] • [[duty shift]] • [[Earth-Romulan War]] • [[erotica]] • [[farm]] • [[fauna]] • [[flora]] • [[Ferengi Rules of Acquisition]] • [[first contact]] • [[fizzbin]] • [[flagship]] • {{dis|flyer|pamphlet}} • [[fruit bat]] • ''[[gagh]]'' • [[gambling den]] • [[Ganarro caterpillar|''Ganarro'' caterpillar]] • ''[[ghay'cha]]'' • [[good cop, bad cop]] • [[graduation]] • [[graffiti]] • [[Griklak]] • [[Griklak hive]] • [[helmet]] • {{dis|hive|structure}} • [[holy war]] • [[Honar]] • [[hydroponic garden]] • [[IDIC]] • [[Jamaican Blue-Mountain-Coffee]] • ''[[jamaharon]]'' • ''[[jehgpu'wI']]'' • [[jug]] • ''[[katheka]]'' • [[Khitomer Accords]] • [[kimono]] • [[Klingon Civil War]] • ''[[klongat]]'' • [[knife]] • [[latinum]] • [[Leppa]] • ''[[leys]]'' • [[machete]] • [[market economy]] • [[meditation]] • [[memoir]] • [[mind meld]] • ''[[nhaidh]]'' • [[Occupation of Bajor]] • [[organ trafficking]] • [[pamphlet]] • [[penal colony]] • [[permit]] • [[plantation]] • [[polemic pamphlet]] • [[pre-warp civilization]] • [[Prime Directive]] • [[propaganda]] • ''[[pujwI']]'' • [[pyramid]] • [[Q'babi juice]] • ''[[raktijino]]'' • ''[[The Raptor's Stroke of Wing]]'' • [[resumé]] • [[reunification]] • [[revolver]] • [[pornography|Risan pornography]] • [[Romulan ale]] • [[saltwater]] • [[Saurian brandy]] • [[scarf]] • [[seaweed]] • [[slipper]] • [[spacewalk]] • [[spray paint]] • [[star music]] • [[Starboard 8]] • [[stardate]] • [[Starfleet uniform (2373-2386)]] • [[steppes]] • [[stock exchange]] • [[rock|stone]] • [[survival training]] • ''{{dis|taj|Klingon}}'' • {{dis|tapestry|art}} • ''[[targ]]'' • [[tattoo]] • ''[[terik]]'' • [[termite]] • [[terrorism]] • [[timber]] • ''[[tjtiq]]'' • [[Tomed Incident]] • [[traffic control]] • [[treaty]] • [[Tzenkethi War]] • ''[[Ushaan]]'' • ''[[Ushaan-tor]]'' • [[warrant]] • ''[[warrigul]]'' • [[water]] • [[Wormhole Surprise]]
:[[alien]] • [[clothing]] • [[energy]] • [[first contact]] • [[fleet]] • [[government]] • [[history]] • [[homeworld]] • [[humanoid]] • [[lifeform]] • [[matter]] • [[nation-state]] • [[planet]] • [[politics]] • [[Purifying Flame]] • [[quadrant]] • [[races and cultures]] • [[rank]] • [[space]] • [[star]] • [[star system]] • [[Starfleet uniform]] • [[Starfleet uniform (2373-2386)]] • [[starship]] • [[technology]] • [[time]] • [[title]] • [[uniform]] • [[universe]] • [[weapon]] • [[year]]
 
   
 
==Appendices==
 
==Appendices==
Line 52: Line 106:
 
*{{n|ST|sub={{st|The Fall}}|The Poisoned Chalice}}
 
*{{n|ST|sub={{st|The Fall}}|The Poisoned Chalice}}
 
*{{n|ST|sub={{st|The Fall}}|Peaceable Kingdoms}}
 
*{{n|ST|sub={{st|The Fall}}|Peaceable Kingdoms}}
  +
 
===Connections===
 
===Connections===
 
{{timeline
 
{{timeline
Line 73: Line 128:
 
===Images===
 
===Images===
 
<gallery>
 
<gallery>
uSS Prometheus 01.jpg|USS ''Prometheus''
+
USS Prometheus 01.jpg|USS ''Prometheus''
 
PROM 1 Prometheus.jpg|USS ''Prometheus'' (English edition)
 
PROM 1 Prometheus.jpg|USS ''Prometheus'' (English edition)
 
Starbase 91.jpeg|Starbase 91
 
Starbase 91.jpeg|Starbase 91
Line 84: Line 139:
   
 
[[de:Feuer gegen Feuer]]
 
[[de:Feuer gegen Feuer]]
[[category:books]]
+
[[Category:Books]]
[[category:pROM novels]]
+
[[Category:PROM novels]]

Revision as of 17:36, 10 December 2019

Fire with Fire (German Feuer gegen Feuer) is a Star Trek: Prometheus novel co-written by Christian Humberg and Bernd Perplies, released in July 2016 in the German language; the English translation started appearing in bookstores on November 22, 2017. It is the first book in the series.

Description

Nahe der Grenze zum Klingonischen Reich ereignen sich mehrere brutale Terroranschläge, die Tausende von Toten fordern.
Wer steckt hinter den Angriffen? Sind es Fanatiker aus dem fremdartigen Volk der Renao, das im benachbarten Lembatta-Cluster siedelt? Oder hat der zwielichtige Typhon-Pakt seine Finger im Spiel? Die Sternenflotte entsendet die U.S.S. Prometheus, ihr kampfstärkstes Schiff, in die Grenzregion, um das Rätsel zu lösen, bevor der nächste Krieg in der Galaxis ausbricht.

English version:

A mysterious terrorist organization has carried out several attacks against the Federation and Klingon Empire. Tensions are running high in a region already crippled by conflict. The perpetrators are tracked to the Lembatta Cluster, a mysterious region of space whose inhabitants, the Renao, regard the Alpha Quadrant's powers as little more than conquering tyrants. The Federation are desperate to prevent more bloodshed, and so have sent their flagship, the U.S.S. Prometheus, into the Cluster to investigate the threat before all-consuming war breaks out.

Summary

Starbase 91 is destroyed in a terrorist attack and a group calling themselves the Purifying Flame from the reclusive Renao species claim responsibility. The USS Prometheus is assigned to investigate: Its captain, Richard Adams, lost his niece Karen in the attack and its crew includes the only Renao in Starfleet, Lieutenant Jassat ak Namur.

Further attacks destroy the Klingon mining planet of Tika 4b and an observation station on Cestus III. The Klingons despatch the IKS Bortas, commanded by Captain Kromm, a drunken member of a noble family, to assist the Prometheus, accompanied by Alexander Rozhenko. Spock is also sent as a Federation special envoy.

Examination of the wreckage of Starbase 91 suggests that the attackers used Romulan ships and explosives to launch a suicide attack. Spock has Thokal, a colleague in the Unification movement and former Tal Shiar member, investigate and determine that the Renao have acquired surplus equipment that went missing when the Imperial Romulan State was re-absorbed into the empire.

The Federation and Klingon personnel search the Renao homeworld, Onferin, but Prometheus chief of security Lenissa zh'Thiin and chief engineer Jenna Winona Kirk (great-great-niece of James T.) are captured by the Purifying Flame along with their Klingon colleagues, and held hostage so both Starfleet and the Klingons leave the planet.

Jassat reluctantly reports two old friends as Purifying Flame sympathisers and the Klingons capture and torture them, learning the location of the Purifying Flame stronghold. Kromm leads a joint operation to attack the base and the terrorists flee in space craft. The Prometheus and Bortas intercept them and rescue the hostages but many escape using a space-folding technique. Spock performs a mind meld with a captured terrorist and learns the Renao are being influenced by someone. The two ships head further into the cluster in search of answers.

References

Characters

USS Prometheus personnel

Richard AdamsGeron BaraiSarita CarsonCeniaChellMassimo CiareseIsabelle CourmontMatthieu CurdinElisa FloresGleesonGralAmanda HarrisJansenJenna Winona KirkMendonAlex MeyerMobaMooreJassat ak NamurJohn PaxonRoaasSenokSimanekT'SaiTabor ReskShantherin th'TaliasLenissa zh'ThiinTricRobert VogelWilorinPaul Winter
Referenced only
GaavGarrett MossT'Shanik

USS Valiant personnel

BhahaniClarkeMark EdwardsFrancoJeremy HadenLinda NozawaPeter Schwartz
Referenced only
DenningGreen

Deep Space 9 personnel and residents

Cenn DescaMornNogMiles O'BrienQuarkRo Laren
Referenced only
Keiko O'Brien

Starbase 91 personnel

Karen AdamsAgramAlariJulie ButchkoFraxaGoldwasserGabriel Marceau
Referenced only
Dimitrios CharistesCoxHillenbrand

Other Starfleet personnel

Leonard James AkaarEzri DaxAlynna NechayevMarkus RohdeSendak
Referenced only
Julian BashirSam BowersRhea KadaniJames T. KirkJamie Samantha KirkKimitake NoguchiJean-Luc PicardWorf

IKS Bortas personnel

BocarBrukkChumarrGrakkKlarnKromm, son of KaathKrogeL'emkaMokbarNukRaspinRoothRuutToras

Other Klingons

Britok, son of GraakGrotek, son of BraktalK'mpochK'mtokKorrtMartokRooth, son of K'mpathAlexander Rozhenko
Referenced only
GowronKaathKahless (clone)Kahless the Unforgettable

Renao

Gilad ak BahailNamoud ak BahailJoruul ak Bhedalak BradulEvykk ak BrusalMossam ak ForalHimad ak GenosJoruunKumaahMoadas ak Lavoorak ManasSeresh ak MomadShamar ak Mousalak PartamiRamou
Referenced only
Creatress

Other characters

Rah-BanVol-BanAltoun DjinianCort EnarenGlomp (Mak) • HararisKevalKyllMaldaroRentoElenor SarinSpockKellessar zh'TarashThokalunnamed Edosians
Referenced only
Carol AdamsNanietta BaccoJulian Bashir (Changeling)Zefram CochraneDivine ExchequerDonatraThomas GrayK'EhleyrGell KamemorGeorge Samuel Kirk, Jr.MakRedjacHelena RozhenkoSergey RozhenkoSarekGideon SeyetikShinzonSon of the Ancient RedsUzavehThomas Wolfe

Starships and vehicles

Aoul-5USS Aventine (Vesta-class) • IKS Bortas (Vor'cha-class) • Charles CoryellKraanalUSS Lakota (Akira-class) • MedibhamonorailUSS Prometheus (Prometheus-class) • Rigelian freighterRomulan transportScorpion class (attack fighter) • USS SolarisTzenkethi marauderUSS Valiant (Constitution-class) • Vel-Tekk (mercenary ship) • yolok
Referenced only
AlgeronAntares-classUSS Bohr (Merian-class) • USS BougainvilleUSS CapitolineUSS DefiantUSS EnterpriseUSS Enterprise-Eescape podExcelsior-classIntrepid-classUSS Iron HorseMiranda-classUSS Red CloudScimitarUSS SutherlandUSS Voyagerwork droneUSS Wyoming (Mediterranean-class) • USS Yukon

Locations

Achernar II (Heliopolis) • Alpha QuadrantAoulBajor sectorBajoran wormholeBeta QuadrantCestus IIICestus systemDeep Space 9 (II) (Quark's) (Frontier-class) • Earth (Paris (Palais de la Concorde) • San Francisco (Starfleet Headquarters)) • Korinar III (Chic Inn) • LC-13LC-13-IILembatta ClusterLembatta Prime (Sun City) • Milky Way GalaxyOnferin (AurounfactoryKonuhbiMassoa) • Qo'noS (Great Hall, First City) • Romulus (Apnex SeaKi Baratan (Admiral Valdore BuildingChalandru)) • Starbase 91 (Starlight Café) (Watchtower-class) • Tika IVTika 4bTika system
Referenced only
AcinaAndorAntaresB'hava'elBadlandsBenzarBeta Antares Ship YardsBetazedBharatrumCapella IVCatoumniChalnaDeep Space 9Delta QuadrantEarth (AlcatrazGreeceNew ZealandSan Francisco (Baker BeachLombard StreetSan Francisco BayStarfleet Communications Research Center)) • Earth Outpost StationEchelon 1Epsilon 119Federation-Klingon borderFerasaFerenginarGamma QuadrantIadLhoeel • (Narad Sea) • Munjeb IIINew France • Onferin (Bhorau Desert) • PraxisRantalRemusRomulan Neutral ZoneSector 221-GSilva sectorSol sectorStarbase 7Tullinar VIUtopia Planitia Fleet YardsVorta VorVulcanXhehenemYssab

Races and cultures

AndorianBajoranBenziteBetazoidBolianCaitianCapellanCardassianChalnothEdosianFerengiGrazeriteHuman (FrenchGermanIrishItalianJapaneseNorwegianSudanese) • KlingonLurianMiradornOrionRantalRenaoRomulanTellariteTiburonianTrill (Trill symbiont) • TzenkethiVulcan
Referenced only
BorgBreenChangeling • Human (AztecMayan) • KinshayaNuvianPakledTholian

States and organizations

CemoudanCouncil of the SpheresFederation CouncilFederation Diplomatic CorpsFederation News ServiceFerengi AllianceHome SpheresHouse of DachoHHouse of KonjahHouse of KrugeKlingon Defense ForceKlingon EmpireKlingon High CouncilOrion SyndicatePurifying FlameRomulan Star EmpireSpherekeepers of AurounStarfleetStarfleet CommandStarfleet IntelligenceTyphon PactTzenkethi CoalitionUnited Federation of Planets
Referenced only
Cardassian UnionCoalition of PlanetsFerengi Commerce AuthorityGorn HegemonyImperial Romulan StateOfficer Exchange ProgramPathfinder ProjectProject Full CircleProject GenesisRomulan Defense MinistryRomulan SenateStarfleet AcademyStarfleet CommunicationsStarfleet Corps of EngineersStarfleet SecurityTal ShiarUnification movementWarp-Speed Classic Vaudeville of Amelia Lukarian

Ranks and titles

admiralagentaideambassadorartistbartenderbekkcaptaincarneyChancellor of the High Council of the Klingon Empirechief engineerchief medical officerchief of operationscommanderCommander-in-Chief of the Federation Starfleetcommunications officerconcubineconn officercouncilorcounselordancerdata analystdeputy chief engineerdeputy chief of securitydiplomatensignfarmerFederation Ambassador to the Klingon EmpireFerengi Ambassador to the Republic of Bajorfirst officerfleet admiralforemangovernorhelmsmansphere keeperKlingon Ambassador to the United Federation of Planetslieutenantlieutenant commanderlieutenant junior gradelinguistlyricistmajormanagermercenarymerchantnavigatoroperations officerpilotpoetPraetor of the Romulan Star EmpirePresident of the Home SpheresPresident of the United Federation of PlanetsRenao Defense Ministerscience officersecond officersecurity chiefsenior chief petty officersmugglertactical officerterroristtheologiantour guideuhlanvegetarianwaiterwatch officerxenozoologistyeoman

Science and technology

aniciumanthraciteantiprotonarcologyartificial gravityastrophysicsatmosphere (magnetosphere) • biobedbiologybloodcameracarbon monoxidecentrifugal forcecloaking deviceclonecombadgecommunicatordata chipdata paddeflector shielddilithiumdisruptordisruptor cannoneclipseelectromagnetic spectrumEMH Mark IIenergy fieldenzymeEPS manifoldEV suitflashlightgas giantgeneticshand scannerholodeckholoemitterholoscreenholovidhoming beaconhypersubspace speedimpulse driveinertial dampenerInterphase cloaking deviceionized particlesisolinear rodlamplife supportlivermassmatter-antimatter reactorminer's lampminingmoleculemulti-vector assault modenebulaneutral atomnitrogenoxygenperma-concretephaserphaser arrayphaser riflephoton torpedoplasmaprotomatterpsychologyquantum slipstream driveradiationreactor breachred giantreplicatorrespiratorrodiniumself destructsensor arrayShedai meta-genomeshield generatorshock pistolsilicatesolar windsound wavesubspace communicationssupernovatachyontachyon detection gridtachyon radiationtekasitetractor beamtransparent aluminumtransportertricobalttricordertrilithiumType-XII phaserultritiumuniversal translatorvolcanowarp bubblewarp drivewarp factorwarp field generator coilwarp nacellexenozoology

Other references

2156216122752305233323592370237423752376238123822340s2350s2360salcoholalgaeAndorian aleAndorian fertility crisisapartmentarmorassassinationbankbat'lethBattle of CardassiaBattle of Vulcanblack marketblackmailblindfoldbloodwineBorg Invasion of 2381brichuSwI'citrusclaycloakcoffeecold warcontractcraterd'k tahgdabodaisdartsdedication plaqueDenIb QatlhDom-jotDominion WarDreaakduty shiftEarth-Romulan WareroticafarmfaunafloraFerengi Rules of Acquisitionfirst contactfizzbinflagshipflyerfruit batgaghgambling denGanarro caterpillarghay'chagood cop, bad copgraduationgraffitiGriklakGriklak hivehelmethiveholy warHonarhydroponic gardenIDICJamaican Blue-Mountain-Coffeejamaharonjehgpu'wI'jugkathekaKhitomer AccordskimonoKlingon Civil WarklongatknifelatinumLeppaleysmachetemarket economymeditationmemoirmind meldnhaidhOccupation of Bajororgan traffickingpamphletpenal colonypermitplantationpolemic pamphletpre-warp civilizationPrime DirectivepropagandapujwI'pyramidQ'babi juiceraktijinoThe Raptor's Stroke of WingresuméreunificationrevolverRisan pornographyRomulan alesaltwaterSaurian brandyscarfseaweedslipperspacewalkspray paintstar musicStarboard 8stardateStarfleet uniform (2373-2386)steppesstock exchangestonesurvival trainingtajtapestrytargtattooteriktermiteterrorismtimbertjtiqTomed Incidenttraffic controltreatyTzenkethi WarUshaanUshaan-torwarrantwarrigulwaterWormhole Surprise

Appendices

Related stories

Connections

published order
Previous novel:
unestablished
Star Trek unnumbered novels Next novel:
Der Ursprung allen Zorns
Previous novel:
first in the series
Novels by:
Christian Humberg & Bernd Perplies
Next novel:
Der Ursprung allen Zorns
chronological order


Images

External links