Memory Beta, non-canon Star Trek Wiki

A friendly reminder regarding spoilers! As always, the expanded Trek universe is in a period of major upheaval with the continuations of Strange New Worlds and Prodigy, the advent of new eras in gaming with the Star Trek Adventures RPG and Star Trek Online, as well as other eventful releases such as Section 31, the ongoing IDW Star Trek comic and spin-off Star Trek: Defiant. Therefore, please be courteous to other users who may not be aware of current developments by using the {{spoiler}}, {{spoilers}} OR {{majorspoiler}} tags when adding new information from sources less than six months old (even if it is minor info). Also, please do not include details in the summary bar when editing pages and do not anticipate making additions relating to sources not yet in release. THANK YOU

READ MORE

Memory Beta, non-canon Star Trek Wiki

Indistinguishable from Magic.

Description[]

The most talented Starfleet engineers of two generations unite to solve a two-hundred-year-old technological mystery that turns out to be only the beginning of a wider quest.
With the support of Guinan and Nog, as well as the crew of the USS Challenger, Geordi La Forge and Montgomery Scott soon find themselves drawn into a larger, deadlier, and far more personal adventure. Helped by old friends and hindered by old enemies, their investigation will come to threaten everything they hold dear.
Seeking out the new, and going where no one has gone before, Geordi, Scotty, and Guinan find that their pasts are very much of the present, and must determine whether any sufficiently advanced technology is really indistinguishable from magic.

Summary[]

2161[]

In 2161, shortly after the end of the Romulan War, the Intrepid is undergoing repairs to her hull in deep space when Captain Jason Lambert – on the hull in an EV suit overseeing repairs – observes a flare nearby. In the process of reporting a possible Romulan minefield to Starfleet, communications are abruptly cut off and no trace of the Intrepid is ever found.

2383[]

In 2383, the USS Enterprise is exploring the Agni Cluster in order to locate potential colonies for the remaining refugees of the Borg Invasion two years earlier. But the crew is soon distracted by the discovery of the Intrepid NX-07, pocked by micrometeorites and aged, drifting in space. After the vessel is determined to be safe, Geordi La Forge and Jasminder Choudhury transport over to discovery a horrifying sight – the dissolved residual remains of the crew, victims of an apparent failure of the inertial dampeners. When Starfleet decides to send in the USS Challenger, Geordi is temporarily reassigned under its captain, Montgomery Scott. Soon Geordi learns Guinan will be joining him on the Challenger, along with a number of other familiar faces already assigned to the vessel, including: Nog, Leah Brahms, Reginald Barclay, Alyssa Ogawa, and a time-traveling thief the Enterprise apprehended fifteen years earlier, Berlinghoff Rasmussen.

2161[]

Shortly after the disappearance of the Intrepid, the 22nd century inventor, Berlinghoff Rasmussen (or B.R.) encounters the 26th century historian, Dominic Kent in Trenton, NJ. After following Kent for several days, Rasmussen breaks into his apartment – in order to determine if Kent stole an invention of his – only to discover evidence that Kent is from the future, including a small time-ship. After Rasmussen confronts Kent, the professor eventually acknowledges his origins but continues to be evasive with details about his time. Nevertheless, the two men fall into an unusual friendship. Having hidden the time-pod to prevent Kent’s escape, the professor asks Rasmussen to grant him access to obtain medication stored aboard – but when Rasmussen fears it is a ploy to escape, he refuses, and Kent dies.

2383[]

After the Challenger crew gets the Intrepid functional, and the former crew’s dissolved remains collected, a Klingon vessel decloaks and attacks, luring the Challenger away from Intrepid. It soon becomes apparent that the Klingon vessel was stolen, when a Ferengi marauder and another Klingon vessel decloak and – led by DaiMon Bok and with Rasmussen’s help – a group of pirates steal the Intrepid. (TNG episodes: "The Battle", "Bloodlines")

When the Intrepid is underway, Rasmussen and Bok invite the Starfleet officers to continue working on the vessel – which Geordi accepts in hopes of finding some way to contact the Challenger. As Geordi and the others resume work, he tries to understand the agenda of the thieves and sow discord between Bok and Rasmussen. Meanwhile, on the Challenger, Nog uses his father’s authority to extract information from the thieves’ captured comrades, eventually leading the crew to realize that Bok is taking the Intrepid to the Split Infinite – the intersection of a cosmic string and a neutron star – in hopes of riding the string back in time. Onboard the Intrepid, Geordi learns the same terrifying truth and realizes that Rasmussen plans to take the Intrepid back to the 22nd century – while Bok makes a daring effort to save his son. In the process of preventing Bok from escaping into the past, the Challenger used the closed timelike curve of the Infinite to force the Intrepid further back in time until the Big Bang destroyed the vessel. In the final pitched struggle, Rasmussen escaped and Scotty was injured.

Shortly afterward, Dr. Ogawa informs Captain Scott that injuries sustained during the battle – coupled with his age – prevent him from meeting Starfleet fitness standards. Subsequently, Scotty chooses to retire from Starfleet, become a civilian specialist, and promotes Geordi La Forge to captain, giving him command of the Challenger. Meanwhile, the Tal Shiar obtain intelligence of Bok and Rasmussen’s efforts to travel through time and began researching their methods.

The investigation of the Intrepid leads Geordi to postulate that something akin to trans-slipstream is responsible for the vessel’s circumstances – and the data share peculiar similarities to telemetry transmitted by the USS Hera shortly before her disappearance, under the command of Geordi’s mother. This leads Geordi and the Challenger to investigate the trans-slipstream wake. Meanwhile, a sabotaged Romulan vessel carrying Sela, the chairman of the Tal Shiar, is forced into Federation space and rescued by the Challenger shortly before the Challenger is struck by an alien force. After bringing systems online, the crew find themselves outside the galactic barrier, and they soon discover the USS Hera floating in the void.

As the crew works to try and restore all of Challenger's systems, Sela plots to take control of the ship and suspects that Starfleet secretly controls the trans-slipstream technology. A series of bizarre readings leads Geordi to order an away team to the Hera, led by Scotty. The shuttle disappears en route, at the same time that strange alien vessels appear on the scene - the presumed trans-slipstream travelers. However, the away team soon wakes on an alien world, surrounded by evidence that the crew of the Hera survived and built a colony there. A number of even stranger occurrences leads Barclay and Scotty to propose that they occupy a toroidal continuum fold - a phenomenon which could explain why the Hera initially exhibited a mass far beyond its size.

The away team soon discovers fifty-seven survivors from the Hera, including the former first officer, Savar. The Vulcan explains the psycho-reactive nature of the living planet the team has crashed on, and explains the futility of attempting to travel back through the toroidal continuum fold to reach Challenger.

Meanwhile, on their side of the fold, the Challenger crew watches the alien vessels amass a small fleet before the Tomalak's Fist, the Romulan vessel searching for Sela, is displaced into the same area of space as the Challenger. When Guinan confesses memories of the alien vessels from her time in the Nexus, Sela stages a takeover of the Challenger but agrees to cooperate when Dr. Ogawa develops a way for Guinan to communicate with the aliens. The alien vessels are, in fact, alien lifeforms of immense size and power -- who express surprise and regret upon learning that their travels in the Milky Way Galaxy were harming its residents, and they agree to be more careful in the future.

Barclay and Scotty devise a method to communicate through the fold, which leads the Challenger to mount an ill-fated mission to open the toroidal continuum fold -- with the help of the Tomalak's Fist -- by widening the fold with a static warp bubble. After the entire complement of the Challenger is transported to the Tomalak's Fist, the former effects its widening of the fold, allowing the Romulan vessel to fly through to the rogue planetoid. The away team is transported up, but not before Geordi is able to finally say goodbye at his mother's grave. The living planet begins responding by launching "antibodies" to attack the Romulan ship. But after Dr. Ogawa informs the rescued Scotty that his organ failure may be irreversible, the ancient engineer chooses to lay his life on the line. After stealing away to the Challenger, Scotty holds the ship until the Tomalak's Fist travels back through the fold and destroys the Starfleet vessel to un-fold space and close the opening. But at the instant the ship implodes, Scotty is transported away -- unsure if he'll survive inside the toroidal continuum fold, but prepared for the possibility of death.

After the living trans-slipstream ships deliver the Tomalak's Fist back home, Sela delivers the Starfleet crew to the USS Enterprise. With the destruction of the Challenger, the crew prepares to go their separate ways, with Geordi returning to the Enterprise, retaining the rank of captain of engineering. Having began a romantic relationship during the assignment, Leah Brahms chooses to stay for a time with Geordi. A final occasion brings them together for the memorial service of Scotty, held aboard the Enterprise and attended by Spock, Sonya Gomez and other familiar faces.

References[]

Characters[]

Zeinab al-QatabiBalisReginald BarclayBokLeah BrahmsRoland BrazziAnna ByelevCarolanCarterJasminder ChoudhurySean CollinsHarry CroftBeverly CrusherSonya GomezGrakGuinanHallidayHargaTyler HuntJoK'VadraGell KamemorYukio KawazanaDominic KentLeon KhalidJames T. KirkKovacKrenGeordi La ForgeJason LambertGustav LarssenM'RsyaMaristMichaelsNogAlyssa OgawaJean-Luc PicardQat'qaQ'HapBerlinghoff RasmussenSaldisSavarMontgomery ScottSelaSloeSpockSpotTaurikMor glasch TevTomalakTornanGeorges ToussaintTrellunnamed Breenunnamed Ferengiunnamed Humansunnamed Klingonsunnamed Nausicaansunnamed Romulansunnamed Tellaritesunnamed VulcansVaraanEmilia VargasJano VellilVoktraVolWorf
Referenced only
Alexander the GreatJonathan ArcherAzetburB'EtorMichael BakerHoward CarterCheshire catZephram CochraneDataJadzia DaxElizabeth DehnerThe DoctorFek'lehrFlaxMatt FranklinMalcolm FrazerStephen Garrovick (I)GomtuuGowronPhillip GreenGrim ReaperTamala HarstadSherlock HolmesKathryn JanewayKahlessEdward La ForgeSilva La ForgeLeetaLursaGary MitchellMiles O'BrienOdoOrion the HunterNoah PowellQQiQ'asQuarkTelek R'MorRehaekRojanRomRo LarenSatan/DevilServalGary SevenSeven of NineWilliam ShakespearePercy Bysshe ShelleyBenjamin SiskoTolian SoranHikaru SuluT'PrenDeanna TroiTutankhamenunnamed El-AuriansJason VigoVolskiarPatrick WestTasha Yar

Starships and vehicles[]

USS Agamemnon (Sovereign-class) • USS Challenger (Galaxy-class) • USS Clyde (Danube-class runabout) • USS da Vinci (Saber-class) • D'deridex-class warbirdD'Kora-class Ferengi marauderDominic Kent's time pod (time pod) • USS Enterprise (Constitution-class) • USS Enterprise-E (Sovereign-class) • gravsledgroundcarUSS Hera (Nebula-class) • Intrepid (NX-07) (NX-class) • IKS Iw'Bat (B'rel-class bird-of-prey) • K'Tinga-class battlecruiserNi'Var (Suurok-class) • picket shipRogue planet antibody vesselshuttlepodIRW Stormcrow (Valdore-class) • support shuttle (shuttlecraft) • USS Thames (Danube-class runabout) • IRW Tomalak's FisttransportUSS Vesta (Vesta-class) • Vor'cha-class warship
Referenced only
airplaneAkira-classUSS Aventine (Vesta-class) • boatchariotColumbia (NX-02) (NX-class) • D-7-classDaedalus-classD'Vey Fek'lehrEnterprise (NX-01) (NX-class) • USS Enterprise-AUSS Enterprise-B (Excelsior-class) • USS Enterprise-D (Galaxy-class) • escape podUSS Excelsior (Excelsior-class) • Flying DutchmanUSS Hood (Excelsior-class) • USS JenolenKlingon stormbirdKorvallen freighter (freighter) • USS Lexington (Nebula-class) • lifeboatMiranda-classOberth-classPhoenixsalvage vesselspace shuttleUSS Stargazer (Constellation-class) • USS Titan (Luna-class) • truckvanUSS Voyager (Intrepid-class)

Locations[]

Agni ClusterAlpha QuadrantAlpha Six-FourBolus ReachDelta Five Gamma Zeta AlphaEarth (Cheep'N'Cheerful MotelThe Hidden PandaNew JerseyNew Zealand Penal SettlementSan FranciscoStarfleet HeadquartersTrenton) • G-231galactic barrierthe galaxyGamma Zeta Alpha ClusterGarath systemGlintaraHappy Bottom Riding ClubIndra IVintergalactic voidNelson'sNGC 4414RemusRogue planet (Hera City) • Romulan Neutral ZoneRomulusSplit InfiniteTal Shiar Headquartersunnamed stars and systemsWexx (Starbase 410)
Referenced only
Andromeda GalaxyBeta QuadrantDeep Space 9Delta Quadrant • Earth (AlaskaBelgiumCambridgeForth BridgeGreat PyramidKansasManchesterNew ZealandNullarbor PlainSaharaScotlandScottish HighlandsStonehenge) • Earth SpacedockFerenginar (Rog Prison) • Gre'thorHellJupiter StationKaladian systemL-374LunaMarsMirror universeNorpin VPacificaPenthara IVRisaSkybridge of VanalisStarfleet MuseumSto-vo-korTellarTen-ForwardUtopia PlanitiaValkenVeridian IIIVoloczin homeworldWarlock Station

Races and cultures[]

AndorianBajoranBenziteBolianBreenCaitianDenobulanEl-AurianFerengiKlingonHuman (Anglo-KoreanAsianBritishCelticCubanEnglishmanEurasianFrenchmanHispanicIndianNew ZealanderScottish) • NausicaanRomulanTellariteunnamed races and culturesVoloczinVulcan
Referenced only
BetazoidBorgCardassian • Human (Chinese) • KelvanKriosianNeanderthalOrganianOrionQXindi-Insectoid

States and organizations[]

Bajoran MilitiaDaystrom InstituteDepartment of Temporal InvestigationsDominionFederation CouncilFederation Diplomatic CorpsFederation News ServiceFerengi AllianceFerengi Commerce AuthorityHouse of DurasHouse of QangImperial Senate of the Romulan Star EmpireInformation Recovery DirectorateKlingon Defense ForceKlingon EmpireKlingon High CouncilMaquisMars-Venus ProjectNausicaan cartelsOrion SyndicatePathfinder ProjectProject GenesisQ ContinuumRepublic of BajorRomulan Engineering CorpsRomulan Star EmpireRoyal NavySecurity team alphaSecurity team deltaShadow TreasurersShort-Change ProjectStarfleetStarfleet AcademyStarfleet CommandStarfleet Corps of EngineersStarfleet IntelligenceStarfleet MedicalStarfleet SecurityTal ShiarTechnical DirectorateT'Lani BureauTyphon PactUnited Federation of PlanetsVulcan Science Council

Science and classification[]

3D projectionadhesive patchairlockalienalpha rhythmalternate timelineanalgesicanalyzerandroidanesthetic gasanimalannular confinement beamantibodyanticoagulantantimatteranyonartificial intelligenceastrometrics computerastrophysicsatmosphereatmosphere shieldauditory cortexautodestruct systemautopilotaxonbacteriaBig Bangbiobedbiomatterbiosynthetic prosthesisblack holeblack starbloodblood cellblood sugarbombboneboneknitterbrainbrain scannerbrainwavebulletbuoyBussard collectorcablecannonballcarboncargo transportercellular regeneration therapycellular regeneratorcentimeterchemicalchemical cleanserchronitonchronometerchronotronchronotron refraction indexcircuitcircuit junctionclass-4 Romulan mineclass-10 probecloaking devicecloaking fieldclockcogcollar bonecollectorcombadgecommand chaircomm systemcommunicationscommunications relaycommunicatorcomnetcomnet padcompanelcomputercomputer coreconduitconnector webconservation of realitycontainment fieldcontrol panelcoolantcosmic stringcutting torchcybernetic eyecyberneticsdashboard consoledata bankdata crystaldata slatedatabasedeck platedeep-scanning nodedeflectordeflector arraydeflector dishdelta rhythmdendritedilithiumdilithium chamberdilithium cradledilithium frame articulationdilithium matrixdilithium matrix monitordimensiondiseasedisruption emitterdisruptordisruptor bankdisruptor pistoldisruptor rifledistribution nodeDNADNA markerdocking latchdocking umbilicalDoomsday machinedoor lockdrugeardrumegg shellelectrical fieldelectricityelectronicelevatorEM bandEM interferenceemergency lightemergency release chargeEMHemulatorenergizing coilenergyenergy weaponengineenvironmental suitEPS gridevolutionexobiologyfeedback loopfelinefirefire suppression gasfirmwareflagshipflashbulbflashlightflight packfood blenderforce fieldforce field generatorforensicsfossilfossilizationfreezerfungusgalaxygamma radiationgamma ray burstgangliagasgas giantG-Class stargene poolgeneratorGenesis DeviceGenesis Wavegeologygoose bumpgravimetric distortiongravimetric eddygravimetric interferencegravimetric pulsegravitational fieldgravitational micro-lensinggravitational sheargravitygravity fieldgravity gridgravity wavegravity waveguidegravity wellgrav-sledgrenadeGuardian of Foreverguidance chipguillotinegyroscopehadronhailhairhand-held beaconhand phaserHarker-Wade patterned coilheadachehearthertzhistorical databaseholodeckhologramholographic master systems displayhologridholonovelholoprogramhomeostatic factor of the universehourhull platehydrogenhypoiceimpulse engineinchinducerinertial dampenerinertial dampening systeminjectorintercominternal combustion engineinterphase cloaking deviceion stormisolinear chipjammingJefferies power loopjury riggingKelvan deviceKelvinkidneykilogramkilometerkinetodynamic energykinetoplasmadynamicKlein bottlelamplaser-cutterlauncherLCARSleafleptonlife supportlifeformlight-yearliquidlong-range sensorlungmagnetic bootsmagnetic dronemagnetospheremagnetmakeshift descramblermaneuvering thrusterMark I EMHmarker buoymass-attractormaster situation monitormaster systems consolemattermatter-antimatter intermix chambermatter echomatter-synthesis systemmedical sensormedical tricordermedicinemedkitmetermethanemetric tonmicronmileminemine detectorminutemirrormissilemission moduleMöbius stripmolecular cuttermoleculemonitormonofilamentmotion sensormuscle tissuemutationnacelle radiatornailnanometernanosecondnavigational buoynavigational computernavigational deflectornavigational displaynebulanegative gneonnerve plexusneuro-electrical energyneurogenic patchneuronneuroscannerneutrinoneutrino bandneutrino waveneutron starNexusnovaoctopoidODN cableoilOld Scaleoptronic cableoptronic circuitorbital tetherorbitoxygenpaddpadlockpainkillerparallel universeparsecparticlepassive sensorpattern enhancerphase cannonphase discriminatorphase inverterphase pistolphase riflephaserphaser bankphaser-cutterphaser riflephotonic missilephotonic torpedophoton flarephoton torpedophotospherepistolplanetary deflector shieldplasmaplasma boltplasma inducerplasma injectorplasma stormplasma torpedoplasma welderplate tectonicspolarized hull platingpolyhedronportable generatorpower conduitpower distribution nodepower gridpower junctionpower transfer beampower transfer conduitpressure waveprobeprojectile weaponpropulsion systemprostheticproteinprotonpsycho-surgerypulsarquantum filamentquantum granulationquantum singularityquantum slipstream drivequantum slipstream mechanicsquark-gluon plasmaradiationradiogenic fieldradiogenic markerradiogenic particleradiorainreactorreceptor circuitred giantrelay stationremote controlremote detonatorreplicatorretinareverse-engineeringribriflerivetrocket fuelRomulan telepresence weaponrootsatellitescannerscience computerscientific methodsecondself-sealing stemboltsensorsensor arraysensor nodesensor sweepseparator moduleservoservo armshield harmonicshieldsshowerSims beaconskeletonskullslingshot effectslipstream wakesodiumsoftware wormsolar masssolvency fieldsonic disruption fieldspacespace stationspaceshipspannerspatial foldspatial manifoldspeakerspinespleensporespotlightstarbasestarshipstarstar chartstar systemstasis chamberstasis fieldstasis modulestasis storage installationstatic warp shellstatorstator backupstealth probesteam enginestimulantstun grenadesublightsubsonicsubspacesubspace distortionsubspace distortion fieldsubspace granulationsubspace gravity inversionsubspace gravity spikesubspace relaysupernovasurgerytachyon detection gridtactical databasetactical sensortargeting scannertelescopetemporal diffraction indextemporal slingshottentacleterraformingtheta rhythmthrustertimetime machinetime traveltimelinetimerTipler cylinderT'Lani Bureau type plasma injectortontoothtoroidal continuum foldtorpedotorpedo launchertorpedo tubetoxintractor beamtranslation matrixtransportertransporter buffertransporter inhibitortransporter padtransporter relaytrans-slipstreamtrans-slipstream drivetranswarp conduittricordertri-ox compoundtsunamitumorturboliftType 3 singularityuniversal translatoruniversevacuum cleanerventilation systemviewportviewscreenVISORvisual cortexvolcanismwarheadwarp coilwarp corewarp drivewarp factorwarp fieldwarp-jumpwarp matrixwarp nacellewarp reactorwarp ringwarp theorywarp trailwaterwatchwheelwombwormholeX-rayzero-g

Occupations and titles[]

admiralagentambassadorassassinastronomerbodyguardboxerbusinessmancaptaincaptain of engineeringcase officercenturionchairmanChairman of the Tal ShiarchancellorChancellor of the High Council of the Klingon Empirechefchiefchief engineerchief medical officerChief of Starfleet Intelligencecivilian specialistcommandercommunications officerconmanconn officerco-pilotcounselordabo girlDaiMondecoratordeputydignitarydiplomatdirectordoctorduty officerengineerensignentomologistexecutionerexecutive officerfigure skaterfirst officerflight controllerforensic technicianfreebootergeneralgeologistgovernorGrand Nagus of the Ferengi Alliancegrave robbergunmanhelmsmanhistorianhostessinterninventorjunior lieutenantjunior officerkinglieutenantlieutenant commanderliquidatormagicianmatriarchmedicmedical technicianmercenarymiracle workermission specialistnavigatornews anchornurseofficerops ensignops officerpaymasterphysicistpianistpilotpiratepoliticianpost captainPraetor of the Romulan Star Empirepresidentprivate contractorproconsulprofessorpsychiatristquartermasterrefugeesailorscience officerscientistsecond officersecurity chiefsecurity guardsecurity officersenior officersensor officersmugglersoldierspecialiststeam engineersubcommandertactical officertacticianteachertechnical directortechniciantest-pilotthieftouristtransporter chiefwarrior

Other references[]

2150s2155216021612164218022202280s231218th century19th century20th century22nd century23rd century24th century26th centuryaccess draweraccess panelalcoholicalcoholalphabetaluminum crystalfoamangelanniversaryantanvilapocalypseApollo moon landingsapplearachnidarchaeologyarmorarmoryarmrestartassassinationasteroidastrometricsauthorization codeautomated distress signalauxiliary controlaway teambachelorette partybadgeballballoonballoon animalbankbarrel-rollbasaltbathroombattle bridgeBattle of Maxiabeachbedroombeebeltbeta shiftBigfootbiopsy labbirdbirthdaybirth certificateblack marketblackmailbladebleachblueprintbonnetbooby trapbookbootBorg Invasion of 2381bourbonbrainwashingbrickbridgebridgebriefing roombrigbronzebrushbuffetbugbulkheadbullbureaucracybutterflycadavercafécampuscappuccinoCaptain's logcaramelCardassian sunrisecardboardcargo baycarouselcarrier signalcartoncatcatwalkcaveceasefirecementcenturyceramicchickenchinaChinese foodChinese water torturechromecitycivil warClarke's LawClass Mclaustrophobiaclaymore swordclothingclothcoatcocktailcocktail stickcoffeecoffincoliseumcolonycommand fitness requirementcometconcertoconference roomcontractcorpsecorridorcountrycowcrabcreamcrock potcrowcuckoocurrencycurve ballcushtidate stampdaydecadededication plaquedegHdesertdesk jockeydiamonddistillerydocking baydocking towerdogdogfightDominion Wardonutdoor chimedormitorydormousedragondress uniformduckduraniumduritaniumduty rosterEarl GreyEarth-Romulan Warelephantemergency field hospitalemergency saucer separationemotionempathyengineeringengineer's vestEnglish languageentry visaequipment beltescape hatchethanoleulogyexecutionfaceplatefarmFederation Standardfence-postFerengi Rules of Acquisitionfield jacketfield kitfile archivefile dumpfiling cabinetfirst contactfishfish tankflambeauxfleaflowerflyfoodforestfortFrench languagefruitfuneralgaragegauntletgeodeGerman languageghostgiant squidglassglovegoldgoosegorillagovernmentgranitegraveground pounderhathawkhelmhelmethilt guardhistoryHoly Grailhomeworldhorsehorseshoehospitalhot chocolatehullhumanoidhypochondriaciced teaIFF transponder codeimmortalityincenseinertial dampening failureinsigniainspection hatchinterrogation cellironislandJefferies tubejerkinjewelJolan truJovian planetjumpsuitkanarkeramidekevlarKhitomer ConferencekisskiteklaxonkleptomaniacKlingon Civil Warlaboratoryladderlanding partylandslidelanguagelatinumLatinlaunch bayleatherlibrarylintelLoch Ness MonsterlockerlogicloonmackerelmagicMalkymalt scotchmantraMartian dustmaskmedalmemorial servicemenumess hallmetalmeteoroidmeteormicrometeoroidmicroscopic breachmilitarymilkmillenniamind meldmine fieldmineralmining cartmining stationmodelmok'baramoldmolybdenummoneymonkeymonstermonthmoonmorguemossmotelmothmuseummushroommusicmustachemythneoprenenewspapernickelNorth American Thunderbirdobservation loungeobsidianoceanOfficer Exchange ProgramoliveOort cloudops consoleovershirtpaintpaperpaperweightpeace lilypenal colonypennypetaQpetpharmacypicklepipplanetoidplanetplasticpolyduranideponytailpower flow chartprayerprefix codeprimary hullPrime Directivepriority downlinkpromotionpropagandaprune juicepry barpunch-cardpuppetpuzzleQ Civil Warqapla'quadrantquartersquartzQu'vatlhrabbitraktajinorankraptorrationratrazorready roomrecordingred alertRekellian Kasprareligionrestraintsriverroberockrubberrubber bandrumsandstonesausageschoolsciencescience fictionscience stationScotch whiskysea serpentseaportsearch patternseasicknessseat cushionsecondary hullsectorself destructself-storage garagesenior staffsensor logserpentservice numbersharksheepshieldship exchange programshirtshrapnelshuttlebaysickbaysidewalkSiege of AR-558silksilverskyscraperslackssnakespacewalkspecterspratsquidstardateStarfleet uniformstatuesteelstreamersuedesuicidesummerswimming pooltactical alerttactical consoletargtattootaverntaxteatechnologytelepathyTemporal Prime Directivetextbookthoroughbreadtickettitaniumtoasttomatotombtongotooltool kittorpedo baytourniquettoweltoytransparent aluminumtransponder codetransporter logtransporter phobiatransporter roomtransport pooltreatyTreaty of AlgerontritaniumtrouserstumbriltweedsUFOuniformuniversityvaporwarevestvialVictorian eravisavomitVulcan science archiveswafflewarp core breachwarwar gravewashroomweaponweekwheel clampwhipwine rackwolfworkbenchworkshopWorld Cup gamesyearyellow alertZee-Magnees Prizezombiezoo

Chronology[]

2161
The Intrepid vanishes.
2365
Geordi becomes chief engineer. (19 years before the novel)
2384
The incident aboard the Challenger.

Appendices[]

Related stories[]

Background[]

  • This novel is David A. McIntee's first Star Trek novel; his previous two Star Trek stories were a short story and novella.
  • The novel was initially pitched as a duology, but was commissioned as a single book.[1]
  • The novel was initially to be released under the general Star Trek brand, but it was later decided to release it under the Star Trek: The Next Generation banner.[2]
  • On page 100 Geordi remarks that he has been chief engineer on two Enterprises for 19 years, placing this story in 2384, based on LaForge attaining the position of chief engineer of the Enterprise-D in 2365 just prior to the episode The Child.

Connections[]

Timeline[]

published order
Previous novel:
Paths of Disharmony
TNG novels Next novel:
The Light Fantastic
Previous story:
Reservoir Ferengi
Stories by:
David A. McIntee
Next story:
most recent Star Trek story

Images[]

Translations[]
2013
German : Von Magie nicht zu unterscheiden, translated by Kerstin Fricke. (Cross Cult)

External link[]